Protein Info for GFF3014 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 27 to 290 (264 residues), 113.4 bits, see alignment E=5.5e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 41% identity to reu:Reut_C6213)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF3014 hypothetical protein (Xanthobacter sp. DMC5)
MSARVLPFAVALAAMAMVPLFSTSPFYVNLTSQVAIAAIGALGLNVLVGHAGLNSLGFAV
FPGLTAYLVAWLSTVGGIDPVAAALFALGGTLAVSALFALVALRTTGLGFVMITMALCQI
VWGAAYRWTSVTGGDNGLSGVPRPGGAWLPLEKPEYFLWLCLIVLALALIQLGRFFDSPL
GVALRGTRDQPRRMGAVGYDVWRIRFVAWMLAAAWGAAAGLLYAWYHQFVSPHMMAVTAS
AEVLLMVVAGGAGTLAGPLIGAALVVLLKNLASIWIDRWVMLLGFTFVVIVLLMPDGIVP
GFSRLTAWLKRLRPTPAPKLVPRERADG