Protein Info for GFF3014 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ribose 5-phosphate isomerase A (EC 5.3.1.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 6 to 215 (210 residues), 238.1 bits, E=3.6e-75
• PF06026: Rib_5-P_isom_A
  • amino acids 49 to 213 (165 residues), 203.3 bits, E=1.2e-64

Best Hits

Swiss-Prot: 100% identical to RPIA_SALTI: Ribose-5-phosphate isomerase A (rpiA) from Salmonella typhi

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to ses:SARI_04587)

MetaCyc: 98% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (219 amino acids)

>GFF3014 Ribose 5-phosphate isomerase A (EC 5.3.1.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KGLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREKIIASVAEKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQNVVTDNGNVILDVYGMEILDPI
ALENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK