Protein Info for PS417_15415 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 10 to 224 (215 residues), 56 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU3569)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UUF7 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PS417_15415 membrane protein (Pseudomonas simiae WCS417)
MTDAVPLRQRLLSIDALRGLVILFMLLDHVRETFLLHRQVSDPMTIDSTEPALFVSRTLA
HLCAPVFVLLTGLSAWLYGQKYQGRRDVSAFLFKRGLFLVVLEFTLVNFAWTFQLPPSVI
YMQVIWAIGVSMIALAALVWLPRPLLIAFAVVIIAGHNLLDGLHFETGSALHVPWAILHE
RSWIEVGDSLRLRITYPVLPWIGVIALGYCLGPWFAKSMQPTLRQRYLLLGGVSAWVGFV
VVRAANGYGDTPWQAYDNGVQTLMSFFNITKYPPSLLFLALTLGIGLLLLLAFEQAGAKR
WISMLATFGAAPMFFYLLHLYVLKILYVVCVALFGLNHGNYFGFDGMGAIWLVALLLPLA
LYPPVHWFAGLKARRRDLAWLKYL