Protein Info for PS417_15375 in Pseudomonas simiae WCS417

Annotation: peptidoglycan-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF20142: Scaffold" amino acids 69 to 195 (127 residues), 76.2 bits, see alignment E=6.3e-25 PF01471: PG_binding_1" amino acids 222 to 278 (57 residues), 34.6 bits, see alignment 2.6e-12 PF03734: YkuD" amino acids 308 to 459 (152 residues), 72.1 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU3558)

Predicted SEED Role

"FIG00962473: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7K7 at UniProt or InterPro

Protein Sequence (531 amino acids)

>PS417_15375 peptidoglycan-binding protein (Pseudomonas simiae WCS417)
MFKKHACYLSICLLVAPLVATAVALPVEPLPVTTPAPVDLAPVQQALAQLPSVCPDLARQ
VDAAAQLRLQAFYQQQGNMPLWSADDRRQALQSQLLMLADDGLDPTHYSLPVPDAAANVL
CSDITSSQHYLQALQDLHYGRLQQSRFEPLWHAQPPTRDPNVEVLAFAAQGLQDMAQAFD
QARPSADLYRSLRNAYSTVRQQPLPHWDPVASGPLLRPGMEDPRVPELARRLISGGYLAN
APSGKQYRDELVKAVKAFQLSHSLQADGVIGAGTVAELNISPAVRREQLRINLERFRWLA
QDLEPEGVLVNVAAAQLSVYQSGIPVWQTRLQVGRAERQTPLLKSRITRLTLNPTWTIPP
TIMREDKLPAIRLNPEYLRQQNLQVLDAEGHPLTAEQVDWARPGNILLRQEAGPRNPLGK
IVMRFPNPYSVYLHDTPSQPLFTKGPRAFSSGCVRVEQPLLLRDLLVSPAERARTDELLA
TGLTHEFRLATPVPVLLSYWTVEVNREGGLVYAPDIYGRDLVLMKAMGSVL