Protein Info for GFF3004 in Variovorax sp. SCN45

Annotation: Thymidylate synthase (EC 2.1.1.45)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00303: Thymidylat_synt
  • amino acids 21 to 289 (269 residues), 421 bits, E=8.1e-131
• TIGR03284: thymidylate synthase
  • amino acids 21 to 103 (83 residues), 122.5 bits, E=9.6e-40
  • amino acids 103 to 289 (187 residues), 293.8 bits, E=6.7e-92

Best Hits

Swiss-Prot: 91% identical to TYSY_POLSJ: Thymidylate synthase (thyA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 96% identity to vap:Vapar_1664)

MetaCyc: 70% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)
• pyrimidine deoxyribonucleosides salvage (2/5 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.45

Use Curated BLAST to search for 2.1.1.45

Protein Sequence (289 amino acids)

>GFF3004 Thymidylate synthase (EC 2.1.1.45) (Variovorax sp. SCN45)
MLAPPRKIPNMTSPIRPVRSQYEDFMRHVDTHGVFKSDRTGTGTKSVFGHQMRFDLNEGF
PLVTTKKVHLKSIIQELLWFLTGSSNNNWLKERGVTIWDEWAREDGDLGPVYGVQWRSWP
TPDGGHIDQIADVIKTLKSNPDSRRIIVSAWNVAELSKMALMPCHAFFQFYVAPPQAEGE
RGKLSCQLYQRSADIFLGVPFNIASYALLTHMVAQQCDLDVGDFIWTGGDCHIYSNHAEQ
VALQLSRAPYPYPTLHIKRKPDSIFDYQYEDFEVLDYQHHAAIKAPVAV