Protein Info for GFF3003 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glycine dehydrogenase [decarboxylating] (glycine cleavage system P protein) (EC 1.4.4.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 957 transmembrane" amino acids 751 to 770 (20 residues), see Phobius details PF02347: GDC-P" amino acids 16 to 440 (425 residues), 644.3 bits, see alignment E=1.4e-197 amino acids 481 to 739 (259 residues), 34 bits, see alignment E=2.4e-12 TIGR00461: glycine dehydrogenase" amino acids 17 to 950 (934 residues), 1803.7 bits, see alignment E=0 PF01212: Beta_elim_lyase" amino acids 546 to 684 (139 residues), 28.4 bits, see alignment E=1.5e-10 PF21478: GcvP2_C" amino acids 781 to 902 (122 residues), 198.5 bits, see alignment E=4.1e-63

Best Hits

Swiss-Prot: 64% identical to GCSP1_COLP3: Glycine dehydrogenase (decarboxylating) 1 (gcvP1) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K00281, glycine dehydrogenase [EC: 1.4.4.2] (inferred from 70% identity to avr:B565_1479)

MetaCyc: 96% identical to glycine decarboxylase (Escherichia coli K-12 substr. MG1655)
Glycine dehydrogenase (decarboxylating). [EC: 1.4.1.27, 1.4.4.2]

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (957 amino acids)

>GFF3003 Glycine dehydrogenase [decarboxylating] (glycine cleavage system P protein) (EC 1.4.4.2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTQTLSQLENRGAFIERHIGPDAAQQQEMLNAVGAESLNALTGQIVPKDIQLATPPQVGE
AATEYAALAELKAIAGRNKRFTSYIGMGYTAVQLPPVILRNMLENPGWYTAYTPYQPEVS
QGRLEALLNFQQVTLDLTGLDMASASLLDEATAAAEAMAMAKRVSKLKNANRFFVASDVH
PQTLDVVRTRAETFGFDVIVDDAAKALDHQDVFGVLLQQVGTTGEIHDYSALITELKSRK
VVVSVAADFMALVLLTAPGKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDEFKRSMPGR
IIGVSKDAAGNTALRMAMQTREQHIRREKANSNICTSQVLLANIASLYAVYHGPVGLKRI
ANRIHRLTDILAAGLQQKGLKLRHAHYFDTLCVEVADKAAVLARAEAAEINLRSDIHNAV
GITLDETTTRENVAQLFNVLLGDSHGLNIETLDKDVALDSRSIQQSMLRDDAILTHPVFN
RYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWPEFAELHPFCPPE
QAEGYHQMISQLSDWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHESRNEGHRDICLI
PASAHGTNPASAHMAGMQVVVVACDKNGNIDLDDLRAKAEQHAANLSCIMVTYPSTHGVY
EETIREVCEVVHQFGGQVYLDGANMNAQVGITSPGFIGADVSHLNLHKTFCIPHGGGGPG
MGPIGVKAHLAPFVPGHSVVQIEGMLTRQGAVSAAPFGSASILPISWMYIRMMGAEGLKQ
ASQVAILNANYIASRLKDAYPVLYTGRDGRVAHECILDIRPLKEETGISELDIAKRLIDY
GFHAPTMSFPVAGTLMVEPTESEGKAELDRFIDAMLAIRAEIDQVKAGVWPLEDNPLVNA
PHIQSELVAEWAHPYSREVAVFPAGVADKYWPTVKRLDDVYGDRNLFCSCVPISDYQ