Protein Info for PS417_15350 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 181 to 200 (20 residues), see Phobius details amino acids 207 to 223 (17 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 357 (18 residues), see Phobius details PF04536: TPM_phosphatase" amino acids 39 to 161 (123 residues), 152.1 bits, see alignment E=3.6e-49

Best Hits

KEGG orthology group: K06872, (no description) (inferred from 72% identity to pfs:PFLU3553)

Predicted SEED Role

"Glycine rich protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCX3 at UniProt or InterPro

Protein Sequence (400 amino acids)

>PS417_15350 membrane protein (Pseudomonas simiae WCS417)
MMAILRQSVLSLVALVFLGLLSTAQADTSPIGVALDQRVIDLTDTLDASTTTRLKNQLAD
LEQRKGAQVAVLLVPTTGGASIEDYANQLFRAWKLGRKGVNDGVLLVVAKEDRKVRIEVG
YGLEGTVTDLLAHRIIEEHITPAFRQGDFAGGVSQGVNDLVVLVDGGDLPQIAGPGANPQ
FIAIALAFVIGAIGGVLISAGRLHWRRALIAIAAVTVLLAIFGGGRDWLMFLLVLPLTLL
IGGATFGALWMARSVFYGVVALLAYILGLVVVDQRYADVNFIHWLVFPLGALLALGLYLV
LLVIMKDAWKQSRVGFIARLVAAVGVYVAAGMLMELGRNGWLYAFPIASFAALFIFGKTS
GGSGSGSSDGSSSGSSSSSSSSSSSGGGGSSGGGGASGSW