Protein Info for GFF2994 in Xanthobacter sp. DMC5

Annotation: Hemin transport system permease protein HmuU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 57 to 74 (18 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 231 to 262 (32 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details PF01032: FecCD" amino acids 12 to 322 (311 residues), 266.9 bits, see alignment E=1e-83

Best Hits

Swiss-Prot: 44% identical to BTUC_VIBCH: Vitamin B12 import system permease protein BtuC (btuC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 69% identity to mch:Mchl_3152)

MetaCyc: 38% identical to ferric enterobactin ABC transporter membrane subunit FebD (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF2994 Hemin transport system permease protein HmuU (Xanthobacter sp. DMC5)
MPSRIVLGLGLLVLVLFCASVAVGYAPLDLGAAFGDLLAGRQSLAALVLSELRLPRAILG
AAVGFSLGLTGAALQGLMRNPLADPGVVGVSGAAALGAVIAFYFGFSASFALALPLGGLT
GAAAATAVLLALAARGAGTVMLILAGVALSSLSGALTALALNLAPSPYAALELVFWLMGS
LADRSLVHVALALPFMAVGWVLVLATGPALDALTLGEDAAESLGFPLRRVRLLVIGGTAA
AVGASVAVAGAIGFVGLVVPHLVRPLVGHRPGRLLAASGLAGAALTLGADIVVRLVPTRP
ELQLGVVTALIGAPFFLFLLARLRGVDS