Protein Info for GFF2992 in Xanthobacter sp. DMC5

Annotation: Vitamin B12 transporter BtuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07715: Plug" amino acids 55 to 162 (108 residues), 101.1 bits, see alignment E=5e-33 PF00593: TonB_dep_Rec_b-barrel" amino acids 201 to 631 (431 residues), 134.2 bits, see alignment E=1.3e-42

Best Hits

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>GFF2992 Vitamin B12 transporter BtuB (Xanthobacter sp. DMC5)
MPSLAPSRSRRALPAAALLAFACVPPALAQTADDQNAGDLPTIVVSATGIPTPEDEVASS
VSIVTEQDIARNQQRTLPDVLQSLPGLNVVQTGGPGGTTSVFIRGTNSNHVKVLIDGIDA
GNPAATNGAFDFGKLLASDLERVEVLRGPQSGLYGSDAIGGVISVTTKKGEGPPKVTAYA
EGGALGTFNQYASLTGATEKLAYSFNVTHFSSTDTPVTPQNIVPPGWPINPNAYDNWTYS
TRLDWQATETFAVNFVARYIDTSLAFTPDTYPPPTYAGIPAALRSTAYASMFFTKGEGVW
TALDGSLVTTFGVSDMSSSNPTVGPNPDVNGTYDGDRQVYYVRSNYLVAPGQNLLVGAER
RNESMTSSTAYASVDASTGDTGIYAEYQGNLWNRLFFAANVRYDADDSFGDHTTFRLAPA
LLFDETGTKLKASYGTGFKAPTLYQLYAPYYGNLNLQPEESEGWDAGFEQKAFGERVLFG
VTYFHNNITNLISYDPATYQNVNIPSAVSQGVEAFVAVKVTDRIDARVDYTYTDVVGYVP
PGQPFGAACAPINATSCYPLRRPNNKVSLTLGWRPTDELDLSASLVYASSWWDIVRLTSN
YIDQPGYTVVNLAANYRLNAVTTVFGRIDNLFNQTYENPNGFLAPGFGAYGGVKLTW