Protein Info for GFF2992 in Sphingobium sp. HT1-2

Annotation: Two-component transcriptional response regulator SMc02366, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00072: Response_reg" amino acids 5 to 115 (111 residues), 87.9 bits, see alignment E=5.4e-29 PF00486: Trans_reg_C" amino acids 149 to 224 (76 residues), 98.6 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 51% identical to CUSR_ECOLI: Transcriptional regulatory protein CusR (cusR) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 88% identity to sjp:SJA_C1-07170)

Predicted SEED Role

"response regulator in two-component regulatory system with PhoQ" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF2992 Two-component transcriptional response regulator SMc02366, LuxR family (Sphingobium sp. HT1-2)
MSHKILVVEDDAATAAYIVKGMTEAGFTVDQADNGRDGLFLASDGSYGAIILDRMMPAMD
GMAMLKALRAASIETPVIFLSALGTPEDRVEGLTSGSDDYLTKPFAFAELLARVQLLLRK
AGGNAAVVTSLRYDDLDMDLLARRVKRAGKAIDLQPREFRLLEFFLRHPDQVVTRTMLLE
GVWDYHFDPGTNVIDVHISRLRRKLDDVSDRPLLHTVRGMGYRLGLDG