Protein Info for PS417_15310 in Pseudomonas simiae WCS417

Annotation: type VI secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 TIGR03359: type VI secretion protein, TIGR03359 family" amino acids 3 to 595 (593 residues), 617.5 bits, see alignment E=1.6e-189 PF05947: T6SS_TssF" amino acids 3 to 592 (590 residues), 495.4 bits, see alignment E=1.3e-152

Best Hits

KEGG orthology group: K11896, type VI secretion system protein ImpG (inferred from 67% identity to pfo:Pfl01_5586)

Predicted SEED Role

"Protein ImpG/VasA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIU8 at UniProt or InterPro

Protein Sequence (595 amino acids)

>PS417_15310 type VI secretion protein (Pseudomonas simiae WCS417)
MSFNRYYQSELSALRQLGRQFSERNPALAPFLAEAGQDPDVERLLEGFAFLTGRLRQKLD
DELPELTHSLMHLLWPNYMRPMPAFSMLQFDPLKHSGPDVCVARGTPVESAAVNGERCRF
RTCYATQVLPLRLSALEYGSRAGRGMLSLRLEMSAEGNFSEWTLNRLRLHFAGDRYISQE
LYLGLLRHLEGIELLPLGHDGLPVNGVDGQALSLRLGADQVQPVGFSEEQALIPYPQNTF
PGYRHLQEYFAFPDKYLFVDVGGLGVLQELPVELLKQVSGVMLRFELRSPWGESRQPTLE
NVKLYCTPIVNLFKHDAVPIRLDGKQDEYLLVPGEYSRENASVFSVDSVTGWQPGGRGYK
TYVPFESFEHDVDNDLSDGPASYSIRQRPSTQHAGLETWLAFGNGPGSAQQTLSIELTCT
NHNLPRLLQLGDINLPCEQTPEGLSFRNICAPTASFPPPLDQDFLWRLISNLSLNYLSLS
DINALKVILQTYDLPRYHDRQAQKISERKLGAMRSVSHTAVDRLHRGLPFRGIRIDLSID
PQGFLGHGEVFVFASVLNEFFALYASLNAYHELRVTSTQGDVYLWPPRMGQQPLL