Protein Info for GFF299 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Colicin V production protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details amino acids 22 to 23 (2 residues), see Phobius details transmembrane" amino acids 21 to 21 (1 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details PF02674: Colicin_V" amino acids 5 to 142 (138 residues), 116.6 bits, see alignment E=4.8e-38

Best Hits

KEGG orthology group: K03558, membrane protein required for colicin V production (inferred from 56% identity to pol:Bpro_1606)

Predicted SEED Role

"Colicin V production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF299 Colicin V production protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAVTDWVLLTALLLSVLLGLWRGLVYEVLSVAGWVAAFVLAQAFAEEAGAWLPMDGLSPP
MRLAAGFVLVFVVVAFVAGLGAWLVQKLVASVGLRPVDRVLGGAFGLVRGGVILLAVALV
VSMTQMEGAAWWRESTTASVLSASLHEIKPLLPEAVARYIR