Protein Info for PS417_15300 in Pseudomonas simiae WCS417

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 PF00004: AAA" amino acids 205 to 336 (132 residues), 37 bits, see alignment E=1.7e-12 amino acids 548 to 655 (108 residues), 23.2 bits, see alignment E=3.3e-08 PF17871: AAA_lid_9" amino acids 344 to 436 (93 residues), 94.9 bits, see alignment E=1.1e-30 PF07724: AAA_2" amino acids 543 to 708 (166 residues), 179 bits, see alignment E=3.1e-56 PF07728: AAA_5" amino acids 547 to 665 (119 residues), 33.1 bits, see alignment E=2.1e-11 PF10431: ClpB_D2-small" amino acids 719 to 788 (70 residues), 32.8 bits, see alignment E=2.4e-11

Best Hits

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCW4 at UniProt or InterPro

Protein Sequence (810 amino acids)

>PS417_15300 ATPase AAA (Pseudomonas simiae WCS417)
MMNVDLQQLIQTLTAQARRDLVRAAERCLTRGGREVLVEDLLLALLEHQDGLLVRAMADA
GIEAGELQATLQPKGEASASRNPVFALALVQWLQQALMVAHVELRQAEVDHGALLLALLR
HPLQYAGSAYQVLLSRLDVQRVHGFVLGQAPCPGPAPTVDSLLERFTHDLTRQAREGRID
PVLCRDAEIGQLIDILMRRRKNNPILVGEAGVGKTAVVEGLALRVVTAQVPEPLRDVRVL
TLDMGLLQAGASIKGEFERRLKGVIDEVNASMKPVILFIDEAHTLVGAGAQAGASDAANL
LKPALARGELRTIAATTWSEYKKYFEKDPALARRFQPVLVGEPSVEQAVSILRGLVSVYE
RSHGVYVRDDAVVAAAQMSARYLSGRQLPDKAVDVLDTACARLRTRRDTAPEALQRFYAE
QAEGVRQHQAISRDRQEGFPVDEQVLHGLNLRMETMESERQHLEQCWLEQPTSTQQVCPR
LVAEVISGWTGIPVEQLAFEHSARVLGLADALRARILGQEHAVQALDRNLRAVAAGLNKV
DAPVGVFLLVGPSGVGKTETALALGDLLYGGERFVTTLNMSEFQEKHSLSRLIGAPPGYV
GFGEGGVLTEAVRQRPYSVVLLDEVEKADPEVLNLFYQIFDKGVANDGEGREIDFRNTLI
LMTSNLGSECIGELCAGGQRPEMHVLQEAIRPLLRDHFKPALLARIRVVPYYPVTGEILN
DLTRLKLERLGQRLSLRKLAFSYTPGLVAHMAEHCSHGDSGARFIDQWIELHLLPQVVDR
LLRAMAQDEPLTHVHAYLAGNGMPICEFSQ