Protein Info for PS417_15275 in Pseudomonas simiae WCS417

Annotation: type VI secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR03353: type VI secretion protein, VC_A0114 family" amino acids 5 to 442 (438 residues), 447.8 bits, see alignment E=2e-138 PF05936: T6SS_VasE" amino acids 18 to 440 (423 residues), 434 bits, see alignment E=3.1e-134

Best Hits

KEGG orthology group: K11893, type VI secretion system protein ImpJ (inferred from 67% identity to pst:PSPTO_5420)

Predicted SEED Role

"Uncharacterized protein ImpJ/VasE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1T6U2 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PS417_15275 type VI secretion protein (Pseudomonas simiae WCS417)
MLVHNVIWQEGMLLRPQHLQHNDRYYHRQLNRTRLLSSDAWGFLTLDLDLQYLNLGKVVV
NQASGVLPDGSLFELSGAMEPLVLQVPANAGRQAVYLALPLATENQVEVRRKEQSDVLAR
YVACETEIGDSNAGADSRCQINCARPDLRLMLGEGPSDAFYVKLQVAQVQDSTREDGVSL
DADFVPTFIYLQGTGYVSSCIKEVISLLATRGDAIAARIQGSGASTGAQVGDFLMLQLIN
RAELILRHYLVQAQVRPERLYRELLSILGELSTFANDNKRAQLAVHYRHGDQGASFRGLM
EGLRTVLSSVLEQHAIELVLQQRQYGVLVCPVSDLKLLGTATFILAATAQCDSEELRHRL
PAHLKIGPVERIRELVNLHLAGIKVQPLPVAPRQIPYHAAKTYFMLELSPRDIAQLEQSG
GFAFHASGEFAELELNFWAIRN