Protein Info for GFF2983 in Sphingobium sp. HT1-2

Annotation: Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details amino acids 459 to 478 (20 residues), see Phobius details amino acids 488 to 511 (24 residues), see Phobius details amino acids 528 to 553 (26 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 560 (560 residues), 773.8 bits, see alignment E=5e-237 PF03814: KdpA" amino acids 11 to 559 (549 residues), 812.7 bits, see alignment E=6.1e-249

Best Hits

Swiss-Prot: 67% identical to KDPA_BRADU: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 86% identity to sch:Sphch_1024)

MetaCyc: 58% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>GFF2983 Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1) (Sphingobium sp. HT1-2)
MTFQGWLLIAAFVGILLALTKPMGLWLFALYEGRRTPLHAVFGPIERGFYTLSGIDPDAE
QSWRRYAVHMLLFNVALLLFTYAVLRLQGLLPLNPQGFAGTSSDLAFNTAISFTTNTNWQ
SYSGESTMSNLAQMLGLSIHNFLSAATGIALAFALFRGFARRSAATIGNFWADVTRVTIY
LLLPICIVYALFLIASGVPQTLAGSVDVTTLEGVKQTLALGPVASQEAIKMLGTNGGGFF
NANSAHPFENPTALTNLVQMLSIFVIGFGLTWTFGKAVGNPRQGWAILAAMLVIFLAGVT
VTYWQEAAGNPILHNLGIAGGNMEGKEVRFGIAASALFSVVTTAASCGAVNAMHDSFTAL
GGMIPLFNIQLGEVVIGGVGAGIYGFLLFAILAVFVAGLMVGRTPEYVGKKIESREVKLA
VLAIAVLPLIILGFTAIASVTDAGLAGPLNKGPHGFSEILYAFTSAVGNNGSAFAGLSAN
SPFYNGMLGVAMWIGRFFIIIPMLAIAGSLAAKKYTPETAGSFPTTGALWTGLLVGIVLI
VGGLTFLPSLALGPIADHLAMIRGQLF