Protein Info for GFF2976 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Membrane protein associated with oxaloacetate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 199 to 219 (21 residues), see Phobius details PF01874: CitG" amino acids 102 to 209 (108 residues), 28.7 bits, see alignment E=4.8e-11

Best Hits

KEGG orthology group: None (inferred from 97% identity to spq:SPAB_04176)

Predicted SEED Role

"Membrane protein associated with oxaloacetate decarboxylase" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>GFF2976 Membrane protein associated with oxaloacetate decarboxylase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPSRETILHYVVETVNQITELEPALHLLPWSGVNSAIYEQRFAQCYDEGLCAAQTSAPNV
PQGILPSTDWAQGIGLLCFAAGYMSAGERPLTHNQLCDFVKQAAVGLSPIEGEAASGFST
VRSIALPVFRRLQRDGHASRVLLLQTLLHLVAWKSASQYARQQAQRLLWMGGILGEGGEH
SLLVLDKALREEAVGEKSLPALLIFTSFLAHFPAGPVFID