Protein Info for PS417_15230 in Pseudomonas simiae WCS417

Annotation: 4-hydroxyacetophenone monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 PF07992: Pyr_redox_2" amino acids 9 to 218 (210 residues), 38 bits, see alignment E=4.2e-13 PF00890: FAD_binding_2" amino acids 9 to 46 (38 residues), 20.8 bits, see alignment 6e-08 PF00743: FMO-like" amino acids 10 to 347 (338 residues), 56.7 bits, see alignment E=4.7e-19 PF13738: Pyr_redox_3" amino acids 12 to 225 (214 residues), 47.1 bits, see alignment E=6.2e-16 PF13450: NAD_binding_8" amino acids 12 to 76 (65 residues), 41.7 bits, see alignment E=3.4e-14 PF13434: Lys_Orn_oxgnase" amino acids 76 to 279 (204 residues), 29.7 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 56% identical to BVMO_PSEAE: Baeyer-Villiger monooxygenase (PA1538) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU3537)

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2H1 at UniProt or InterPro

Protein Sequence (512 amino acids)

>PS417_15230 4-hydroxyacetophenone monooxygenase (Pseudomonas simiae WCS417)
MNAQSDSIDIAIIGSGFAGLCMAIKLKKAGFTDFFIAEQADTLGGTWRDNHYPGCACDVQ
SHVYSFSFAPNPDWTRQFAPQAEIRAYLEQCATRYELAPYLRFGMGLERAVFDEQHQRWQ
LRFSDGRQVSARVLVSGMGGLSRPALPDIPGLDSFKGKRFHSQQWDHAYSLKGKRVAVIG
TGASAIQFVPQIASQVAHLDLFQRTPPWIMPKPDRAISPLERWLFKHLPFTQRLVRSAFY
WALEGRVVGFALHPRLMKMVQKIALRHLHKQVARPSLRKTLTPDYTIGCKRVLISNDYYP
ALSRSNVEVVTDNVLRIEADGVITADGIKHPADCLIFGTGFQATDPLPRDCIIGRDGVDL
MDAWRDGAHAYKGTTVPGYPNLFLIVGPNTGLGHNSMILMIEAQVTYILDALEQMQRHRI
ASVDVKPSVESAYNQQLQAKLKRTIWNTGGCQSWYLDPRTGKNTTLWPGSTWRFKRVTRQ
FALKDYVTSRVPIHAPHRPVPTAHSTAEGSLS