Protein Info for PS417_15220 in Pseudomonas simiae WCS417

Annotation: alkane 1-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 266 to 294 (29 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details PF00487: FA_desaturase" amino acids 156 to 377 (222 residues), 106.8 bits, see alignment E=8.4e-35

Best Hits

KEGG orthology group: K00496, alkane 1-monooxygenase [EC: 1.14.15.3] (inferred from 97% identity to pfs:PFLU3535)

Predicted SEED Role

"Alkane-1 monooxygenase (EC 1.14.15.3)" (EC 1.14.15.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U028 at UniProt or InterPro

Protein Sequence (426 amino acids)

>PS417_15220 alkane 1-monooxygenase (Pseudomonas simiae WCS417)
MNQTLAAPSIWTDGKRHLWWLGIMPLATPLLSGALAITTGVQQLWWVGVLVIFGLIPLID
GLLGEDVSNPPESAVSHLESQRYYRWIVYTGVLFVISSVVITGWLAAGGIDWIIQGGLLQ
AAASLEPSSGLSHAASYITTRTQLHGEVSAFTYLGMAMSTGAATGIAINTAHELGHKPNA
LEVFLAKVTLAPTFYGHFYTEHNRGHHVRVATPEDPASSRLGESFWAFLPRSVWFSARSA
WNLERERLRKLGLPAWHWQNGVLSAWMYSVVLWGAMIAWLGAAVIPFLIIQGIYGFSLLE
VVNYVEHYGLKRQKLPNGRYERCSPRHSWNSNRIVTNIFLFQLQRHSDHHANPTRSYQSL
RHFDESPQLPYGYASMIVWAYVPYLWRRRMDHRVLNHYAGDITLTNLQPSQRLKYLEKYS
NSAKPF