Protein Info for GFF2972 in Xanthobacter sp. DMC5

Annotation: ECF RNA polymerase sigma factor SigF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF07638: Sigma70_ECF" amino acids 9 to 176 (168 residues), 27.1 bits, see alignment E=7.5e-10 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 22 to 177 (156 residues), 69.5 bits, see alignment E=1.3e-23 PF04542: Sigma70_r2" amino acids 29 to 98 (70 residues), 50.4 bits, see alignment E=3e-17 PF08281: Sigma70_r4_2" amino acids 123 to 173 (51 residues), 39.4 bits, see alignment E=7.6e-14 PF04545: Sigma70_r4" amino acids 128 to 174 (47 residues), 28.2 bits, see alignment E=2.2e-10

Best Hits

Swiss-Prot: 44% identical to SIGF_CAUVN: ECF RNA polymerase sigma factor SigF (sigF) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 55% identity to bja:blr3038)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>GFF2972 ECF RNA polymerase sigma factor SigF (Xanthobacter sp. DMC5)
MDDRELRWAQLMRSALAGDGAAYEQLLRDLAPALRTVVQRRLVRLGAPTAETEDVVQETL
LAVHLKRHTWRTEDPLGPWLWTIARNKMVDHLRRRGRRVEVPVEDFAEFLPAPEERPDTG
AMEVEQHLALLPQKQQAVLRSVAVEGASVAETAERMRMTPGAVRVALHRAFASLSARLRE
E