Protein Info for GFF2969 in Variovorax sp. SCN45

Annotation: acyl-CoA synthetase (NDP forming type)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 PF13380: CoA_binding_2" amino acids 27 to 153 (127 residues), 76 bits, see alignment E=8.5e-25 PF02629: CoA_binding" amino acids 27 to 117 (91 residues), 31.8 bits, see alignment E=5e-11 PF13607: Succ_CoA_lig" amino acids 173 to 310 (138 residues), 149.3 bits, see alignment E=1.5e-47 PF19045: Ligase_CoA_2" amino acids 324 to 374 (51 residues), 24.6 bits, see alignment 5.7e-09 PF13549: ATP-grasp_5" amino acids 496 to 709 (214 residues), 222.5 bits, see alignment E=1.1e-69

Best Hits

KEGG orthology group: None (inferred from 66% identity to rme:Rmet_4411)

MetaCyc: 60% identical to pimeloyl-CoA synthetase monomer (Pseudomonas mendocina 35)
6-carboxyhexanoate--CoA ligase. [EC: 6.2.1.14]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (718 amino acids)

>GFF2969 acyl-CoA synthetase (NDP forming type) (Variovorax sp. SCN45)
MSTADTMPGAFPNMLANHTLDRLLNPRSVAVIGASDDALRIGGRPIAYMRSQGFSGRLMP
VNPNRAQIQGLPAFASVAALPETPDVAIVAVAAHLAPQVVADLGARGTSAAIVFSAGFAE
MGEDGERLQQRMVEAARAHGVRLLGPNSLGVLNPRIGFYGSFTSVVEMGFPKPGRVGIAS
QSGAYGSHILGIAREFGIGVSSCVMSGNECDISLGDLVRAFVDDGDTDVIAVYSEGIRDG
ARLLDALEAARRARKPVVMMKVGTSAVGSAAAQSHTASIAGNDAVTDAVLAEFGVVRARS
TEHMLDVARLATRRIYPADNSLGVITVSGGAGVIVSDAAELAGLPMPEMPAAAQQHLKAL
IPFAAPRNPVDCTAQFMNDLSIAGRFAEAVVAEGGYRSVLGFFTYTVGAESIADGLRAQL
KAVRDKHPDRLFVLSILASRERVQQYEADGFTVFEDPARAVVAIEAMGRFGRAFARQPAQ
EPPRVPAVALPAANPSEAEAKRVLAEAGIAVAPERACANARDAVAAAEALGFPVVLKILS
PDIVHKSEIGGVLLNVANAGAVREGFAMLMERAALAAPDARIEGVLVAKQLSGGVECILG
IQRDPVFGPVAMFGLGGIFVEVMKDVVLRRCPFGEDVAEQMIRGIQGAPLLLGARGKPVA
DVKALAAMLSRLSVFAHQCGPRLQSIDLNPVLALPQGQGAFAADAVVVLAPVPDSAQG