Protein Info for GFF2962 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details PF03547: Mem_trans" amino acids 11 to 294 (284 residues), 63.1 bits, see alignment E=9e-22

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 72% identity to azc:AZC_0273)

Predicted SEED Role

"Malate permease" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF2962 hypothetical protein (Xanthobacter sp. DMC5)
MHEISLIVTCLVIGVLLRWSGRLPDTATKAFGGWVINVALPATALRSVHQLKMDDGWWLA
AATPWIGAILAILVIVPLCRAFGWSHRRAGALLLVGGWGNTSFVGLPMIAAFAGSQWLGL
GIVIDLFGSYLALSTLGLAIAAVASAGHFDGRAVAKRIATFPPFWAILIAFSTNDVPRPE
WLDQLVEALARTLTPIALAAVGYALRLDRISGRVGALAVGLGYRLLLAPLAIFLMYAALG
RNGDPVAQVAMLEMAMPPMLGASIIALDHDLEADLVALVIGVGVPLSMLTAWMWWGLVIH
P