Protein Info for GFF2956 in Xanthobacter sp. DMC5

Annotation: Riboflavin transport system permease protein RibX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 256 (167 residues), 110 bits, see alignment E=6.2e-36

Best Hits

Swiss-Prot: 36% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 69% identity to vpe:Varpa_3958)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF2956 Riboflavin transport system permease protein RibX (Xanthobacter sp. DMC5)
MTDTLLVQSTRANVLSKLMSMDAIRPLILVAVILVGWDLAVRLLRIPPYLIPAPTLVIEQ
VIAQWPMLLRETMPTLYATLGGFALSALVGIPLAMLIASSKTVESYLYPLLVFSQSVPKI
AVAPLFVVWFGFGVLPKIISAFLLGVFPVVVSTVLAFKSVDKEMIDLARSMRAGGLRTFI
RIRLPHALPGIFSGLKVAITLAVVGAVVGEFVGSNSGIGYVLQVANGNFDLPLMFAALFV
LSMMGVILFMALDAIEHFLIPWHASRRPDINGGA