Protein Info for PS417_15085 in Pseudomonas simiae WCS417

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF20030: bpMoxR" amino acids 12 to 185 (174 residues), 61.8 bits, see alignment E=1.2e-20 PF07726: AAA_3" amino acids 37 to 167 (131 residues), 212.3 bits, see alignment E=4.9e-67 PF07728: AAA_5" amino acids 37 to 165 (129 residues), 42.1 bits, see alignment E=2.2e-14 PF17863: AAA_lid_2" amino acids 246 to 312 (67 residues), 74.6 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 98% identity to pba:PSEBR_a3252)

Predicted SEED Role

"MoxR-like ATPase in aerotolerance operon"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TY15 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PS417_15085 ATPase AAA (Pseudomonas simiae WCS417)
MEHREALLALRTFLSTQILGQEKLIDRLLIALLADGHMLVEGAPGLAKTKAIKELAEGIE
AQFHRIQFTPDLLPADITGTEIYRPETGSFVFQQGPIFHNLVLADEINRAPAKVQSALLE
AMAERQVSVGRSTYDLSPLFLVMATQNPIEQEGTYPLPEAQLDRFLMHVKIGFPDAAVER
RILQQARGEALNGETKPERRVSQQAIFAARKEILGLYMADAVEEYLVQLVMATRTPAKFD
LEMAEWIAYGASPRGSIALDRCARAHAWLAGRDFVSPEDIQAVLFDVLRHRIILSFEAEA
AGIDQDRVVQRILDVVAVA