Protein Info for PS417_15055 in Pseudomonas simiae WCS417

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details amino acids 308 to 339 (32 residues), see Phobius details amino acids 351 to 376 (26 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details PF00375: SDF" amino acids 10 to 402 (393 residues), 340.6 bits, see alignment E=6.3e-106

Best Hits

Swiss-Prot: 77% identical to DCTA1_PSEA7: C4-dicarboxylate transport protein 1 (dctA1) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 98% identity to pfs:PFLU3500)

Predicted SEED Role

"probable dicarboxylate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAF8 at UniProt or InterPro

Protein Sequence (436 amino acids)

>PS417_15055 C4-dicarboxylate ABC transporter (Pseudomonas simiae WCS417)
MLRWCSRSIFLQVVIGLMLGIICGLTLPEFSSQLKPLGDGFIKLIKMLIGLIVFCVVVSG
ISGAGDLKKVGRIGLKSVIYFEILTTVALVIGLVMAFSTGIGTGANIHLEQLSSAGLNEL
ADKGQHIRGTSQFLMDLIPNSVIGAFADNNVLQVLLFSVLFGSALNLVGEAASGISRLIN
ELSHIIFRIMGMIVRLAPIGVFGAIAFTTSTYGLDSLQHLGSLVGLFYLTCFAFVGLILG
LVMRLSGLRMLPLLKYLREELLIVMGTASSDAVLPQIMRKLEHLGIGSSTVGLVIPTGYS
FNLDGFSIYLTLAIVFIANATGTPLSMTDLLTILLVSLITSKGAHGIPGSALVILAATLT
AIPAIPVVGLVLVLAVDWFMGIGRALTNLIGNCVATVAIARWEKDIDIQRANKVLDGQQG
YAFQAKKPVVPAHQEF