Protein Info for GFF294 in Xanthobacter sp. DMC5

Annotation: Amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13522: GATase_6
  • amino acids 138 to 269 (132 residues), 73.7 bits, E=1.5e-24
• PF13537: GATase_7
  • amino acids 147 to 274 (128 residues), 60.3 bits, E=1.9e-20

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_4695)

Predicted SEED Role

"Glutamine amidotransferase protein GlxB (EC 2.4.2.-)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Protein Sequence (299 amino acids)

>GFF294 Amidophosphoribosyltransferase (Xanthobacter sp. DMC5)
MCGIVGLFLKDPKLEGELGAMLASMLCVMTDRGPDSAGFAVYGAGGKDSVKLSLRAARGY
DFEGLAAGLSGPANGMPALALHGTHAVVEIPQVREAAVRAFLAERHPEVAVVGTGSRMEI
FKEVGLPSSVAETFGLAQMRGTHGIGHTRMATESAVTTAGAHPFSTGADQCLVHNGSLSN
HNALRRQLKREGITIETENDSEVAAGYLTWRMREGASLGQALEAGLKDLDGFFTFVVGTE
SGFGVLRDPIACKPAVMAETDQYVAFGSEYRALVDLPGISKAKVFEPEPATVYFWERAQ