Protein Info for GFF2934 in Xanthobacter sp. DMC5

Annotation: Trans-aconitate 2-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF13489: Methyltransf_23" amino acids 16 to 135 (120 residues), 51.8 bits, see alignment E=2.8e-17 PF00891: Methyltransf_2" amino acids 20 to 130 (111 residues), 30.1 bits, see alignment E=1.1e-10 PF01728: FtsJ" amino acids 30 to 90 (61 residues), 25 bits, see alignment E=5.8e-09 PF13847: Methyltransf_31" amino acids 33 to 139 (107 residues), 58.9 bits, see alignment E=1.6e-19 PF13649: Methyltransf_25" amino acids 36 to 125 (90 residues), 64.7 bits, see alignment E=3.7e-21 PF08242: Methyltransf_12" amino acids 37 to 127 (91 residues), 61.4 bits, see alignment E=4.2e-20 PF08241: Methyltransf_11" amino acids 37 to 128 (92 residues), 61.7 bits, see alignment E=3.1e-20

Best Hits

Swiss-Prot: 59% identical to TAM_NITWN: Trans-aconitate 2-methyltransferase (tam) from Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 81% identity to xau:Xaut_1142)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF2934 Trans-aconitate 2-methyltransferase (Xanthobacter sp. DMC5)
MPADWNASQYLKFEDQRTRPARDLLAAVPLQSAAFVVDLGCGPGNSTEILAQRFPGAELL
GLDTSPAMLEAARARLPGVTFALGDASTFTLPKPADLIYANAVLQWVPDHATLLPRLMSL
LAPGGVLAVQMPDNLEEPSHVAMRETAMAGPWADALHTATRARTVLPEPGAYYDMLKPHA
GAVDVWHTIYNHPLDGIPAIVEWVKGTGLRPFIDPLEGDERTQFLEEYAARLSDSYLPRV
DGKVLLAFPRFFIVGVK