Protein Info for GFF2933 in Xanthobacter sp. DMC5

Annotation: Glutamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03951: Gln-synt_N
  • amino acids 6 to 84 (79 residues), 47.3 bits, E=1.2e-16
• PF00120: Gln-synt_C
  • amino acids 105 to 330 (226 residues), 58.8 bits, E=5.1e-20

Best Hits

Swiss-Prot: 88% identical to GLNA2_BRADU: Glutamine synthetase (glnII) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 94% identity to xau:Xaut_1141)

MetaCyc: 48% identical to glutamine synthetase (Arabidopsis thaliana col)
Glutamate--ammonia ligase. [EC: 6.3.1.2]

Predicted SEED Role

"Glutamine synthetase type II, eukaryotic (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of ammonia assimilation (plants) (3/3 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• ammonia assimilation cycle II (2/2 steps found)
• L-glutamine biosynthesis I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-aspartate degradation II (aerobic) (1/3 steps found)
• L-aspartate degradation III (anaerobic) (1/3 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Protein Sequence (344 amino acids)

>GFF2933 Glutamine synthetase (Xanthobacter sp. DMC5)
MPKFKLEYIWLDGYTPVPNLRGKTQIKEYDVFPSLEELPLWGFDGSSTQQAEGRSSDCVL
KPVAVYPDPARTNGALVMCEVMMPDGVTPHPSNKRATILDDAGAWFGFEQEYFFYKNGRP
LGFPEAGYPAPQGPYYTGVGFKNVGDVARQIVEEHLDLCLAAGINHEGINAEVAKGQWEF
QVFGKGSKKAADEVWMARYLLLRLTEKYGVDIEFHCKPLGDTDWNGSGMHANFSTSYMRE
VGGKEYFEKLMAAFEANLDDHIAVYGPDNHMRLTGKHETAPWNKFSYGVADRGASIRVPH
SFIRNDYKGYLEDRRPNSMGDPYQIASQILKTISSVSTDVSAAA