Protein Info for GFF2932 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details PF00892: EamA" amino acids 10 to 143 (134 residues), 41.5 bits, see alignment E=7.5e-15

Best Hits

KEGG orthology group: None (inferred from 69% identity to hse:Hsero_1240)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF2932 putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSGHHPSLALGIGFGAAAGAAWGFVFLAPELARDFSPLQLSAARYLAYGLVALALIAPRW
RAVAPRLGRPEWWALLRLSLLGNILYYVLLASAVQLGGMAMTSLVIGFLPVAVTLIGSRG
HGAVPLRRLALTLALGVAGIACVAWQALGMPSQAPAASRLTGFLCALGALAAWTSYAVSN
SRWLARLDHVSSHDWSLLTGLVTGGLALLLAVPAFLGSSLSDHTGAQWGRFIGVAAGMAV
VASVVGNALWNRASRLLPLTMIGQMILFETLFALLYGFLWEARWPTLLETLAMVLVSASV
LAGISAHQPQPAPEHGN