Protein Info for PS417_14995 in Pseudomonas simiae WCS417

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 366 to 390 (25 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details TIGR00814: serine transporter" amino acids 22 to 414 (393 residues), 542.9 bits, see alignment E=2.5e-167 PF03222: Trp_Tyr_perm" amino acids 34 to 417 (384 residues), 51.2 bits, see alignment E=5.7e-18

Best Hits

Swiss-Prot: 68% identical to SDAC_ECO57: Serine transporter (sdaC) from Escherichia coli O157:H7

KEGG orthology group: K03837, serine transporter (inferred from 97% identity to pfs:PFLU3490)

MetaCyc: 68% identical to L-serine:H+ symporter SdaC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIP4 at UniProt or InterPro

Protein Sequence (425 amino acids)

>PS417_14995 serine/threonine protein kinase (Pseudomonas simiae WCS417)
MNDQANSVDERYATTPATLTSWSRQDTTWMLGLFGTAIGAGTLFLPINAGLGGFWPLVIL
ALLAFPMTFFAHRGLTRFVLSGREGSDITDVVEEHFGIKAGALITLLYFFAIFPILLIYS
VALTNTVGSFMEHQLHIMPPPRAILSFVLILGLLAVVRCGEQVIVKAMSLMVYPFIVALL
FLAVYLIPHWNGGILSTASQVPTPSALLNTLWLAIPVMVFSFNHSPIISAFAVDQKRQYG
IHADERSSQILSRAHLLMVVMVLFFVFSCVLTLSPAQLAEAKAQNLSILSYLANHFNNPT
IEFAAPLIAFVAITKSFLGHYIGASEGLKGLVLKTGRRPGAKRLDRMTAAFMLVVCWIVA
TLNPSILGMIEALGGPIIASILFLMPMYAIRKVPAMAKYRGQASNVFVTAVGLVAITAVV
YSLFA