Protein Info for PS417_14970 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 52 to 54 (3 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 138 to 153 (16 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 282 to 313 (32 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 350 (342 residues), 75.6 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU3485)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UG48 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PS417_14970 MFS transporter (Pseudomonas simiae WCS417)
MRKDYLAFFVSLFLSRLADQILLFIVPLIVFQTTQSVAWAGLAFFVESLPRYLAFPVCGA
LCDKFAPVRILHISQVCRALACGVAVVLYGVFDGILWIVLLSALCGVLTTQGIMAREVLM
PHVFPHYSYAKTLSYSQIADQSGLVLGPLVAALMLEVWAWYWVVLGVAGLFLLADLAMRA
WQRSSTTQLETFEQHRDIWLQPLKIAFGHIRSLPELKRIITLAVGVNLIIGVTLATSAAM
VTGQFAQDKDTYALLQAAGALVTIGILFYLARAGLPLRVLGGLSYSMIAVGAVIMAISPG
IWLYAVGFLLVTGFDKMFNVYLRSTRQRVIPVQDFGKTVGVITLLNNLPQPLAGLAIAVL
AAPLGTQPVILLLAGITALIGAAVASGWHATVKAELDVG