Protein Info for GFF2919 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 58 to 77 (20 residues), see Phobius details amino acids 296 to 326 (31 residues), see Phobius details PF13519: VWA_2" amino acids 94 to 201 (108 residues), 38.2 bits, see alignment E=3.9e-13 PF00515: TPR_1" amino acids 406 to 435 (30 residues), 28.5 bits, see alignment (E = 2e-10) PF07719: TPR_2" amino acids 406 to 435 (30 residues), 26.1 bits, see alignment (E = 1.2e-09) PF13414: TPR_11" amino acids 409 to 442 (34 residues), 29.6 bits, see alignment (E = 8.9e-11)

Best Hits

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (688 amino acids)

>GFF2919 hypothetical protein (Xanthobacter sp. DMC5)
MASFHFLRPEWLLALLPAAILAALLHRRLREGSNDWAREVDPHLLAHLALPGRRASGQWP
AVLLFAGWVAAVFAMAGPTWQKLPQPVTGRLDPLVIAVNLSPTMNAPDASPSRLVAARYK
IADVLQRMRGSEVALVLYSDIPFAAAPLTEDAHVVAQMLPDLSTSLMRGNANRPQAAIAM
AVDLLKGAGAMSGRILLVTDGPGDEPAKTQAAAKAAAAEGYKVNVIGVGAEGANGAPALD
TAALTAIATAGQGAYTPLTADDRDIAYALPPAASSNGAVTDSEGFTADVWADMGPYVLLL
AVLLAPLAFRRGWIAVLALAALGGLAAPQRAQAQTLPQNLTQSLPQSWADMWWRPDQQGA
ADYARGDYAAAAQKFEDPTWKANALYKAGDYSGAAAALSRLPGGDYNRGNALARAGQLEQ
AVAAYDKALAANPDNADAKFNRDLVQKLIDAKKKQEEDKQKQKQDQKQNQAGGGGQDQNK
DQKPDPKSDQKQKQDQKAGGDKPQDAQNSPQPGPLPPPAPLPPRRPSELAQQQPQQQPPQ
QQPQSPPPQEQAKQAPPPDSPPPPLAPQDPSQPPQEPEVMAGDVPAAPVTPKAPPPPMPD
DKENGQDAAKQDPNAAFSAPPTAPSQVAQPKPPQPTPQAPPAVAFSDDDQSREQALRQVP
DDPGGLLRARIRSQYTGAPVFLSEGDAQ