Protein Info for PS417_14910 in Pseudomonas simiae WCS417

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03480: DctP" amino acids 30 to 311 (282 residues), 358.4 bits, see alignment E=1.5e-111 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 30 to 274 (245 residues), 247.5 bits, see alignment E=7.4e-78

Best Hits

Swiss-Prot: 78% identical to DCTP_PSEAE: C4-dicarboxylate-binding periplasmic protein DctP (dctP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 97% identity to pfs:PFLU3470)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7C4 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PS417_14910 C4-dicarboxylate ABC transporter (Pseudomonas simiae WCS417)
MLKLSRALLCAATLFAAGLAQAADPIVIKFAHVVAENTPKGQGALLFKKLAQERLPGRVK
VEVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTQQVQIYDLPFLFNDLAAVDRFQ
AAQGKALLTAMQDKNILGLAYWHNGLKQLSSNKALHEPKDARGLKFRVQASSVLEEQFKA
IRANPRKMSFAEVYQGLQTGTVNGTENTWSNYESQKVNEVQKYFTESNHGLIDYMVITNA
TFWNGLPPDIRSTLEQIMVEVTVEVNKQAEALNQSAKQKIIDAKTSEIIELTPEQRQLWR
EAMRPVWQKFEGEIGADLIKAADASNQ