Protein Info for PS417_14905 in Pseudomonas simiae WCS417

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details PF04290: DctQ" amino acids 67 to 184 (118 residues), 68.1 bits, see alignment E=3.7e-23

Best Hits

Swiss-Prot: 64% identical to DCTQ_PSEAE: C4-dicarboxylate TRAP transporter small permease protein DctQ (dctQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 98% identity to pfs:PFLU3469)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZX9 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PS417_14905 C4-dicarboxylate ABC transporter (Pseudomonas simiae WCS417)
MQTLRRVWEHLEEGFIAFLLAAMTLVTFVYVMLNNIYTLFFALADKWAWSSDFFGALGDH
TMTWAQDMTWSVALTKAMFGWLIFFGISYGVRTAGHLGVDALVKLTKRPVQRVLGMLACL
CCLAYAGLFMIASYKWVTAVMGAHIGAEDLDQYGIDVGDIVVIVPIGFAMVFIRYLEIFY
RIFTHRQVGLGLADEAGEASKLAGSHEERH