Protein Info for GFF2912 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 101.2 bits, see alignment E=1.8e-33 PF00528: BPD_transp_1" amino acids 35 to 208 (174 residues), 71.8 bits, see alignment E=3.1e-24

Best Hits

Swiss-Prot: 30% identical to GLNP_RICTY: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia typhi (strain ATCC VR-144 / Wilmington)

KEGG orthology group: None (inferred from 77% identity to hse:Hsero_4607)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF2912 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MKYSLDFAPLASYWPVFINGAWLTLKMTALAVVIGVAVGTLVAFAKRSKIRLLSRACTIY
IEIVRNTPFLVQIFLLYFGLASFGVRMPTFAAAVLAMVINIAAYAAEIIRAGLESVPRGQ
IEAAECLGLSKWRIGWHVMLQPSIEKVYPALTSQFLLMMQASAMASQISAEELTAIANTV
QSDTFRSLETYIVVAALYLVLSLFIKLVTWALGEYLFRRRRVVRRAAAQAGKMQPAAATA
AVAVHGGAA