Protein Info for GFF2904 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 266 (172 residues), 100.3 bits, see alignment E=5.7e-33

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 86% identity to xau:Xaut_4051)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF2904 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MNISRFKALGEGLLVPVAVVLLWQIACSAGWVNPMVLPSPAAVAARWWSYLAPLEPFDPA
TESKIAWIFSGELIHDSLASLSRVVMGFVVGAGLALPLGLFMGTSDSIYRYVNPLMQVLR
PIPPIAYIPLSILWFGLGNAPAVFLIAIGAFFPVLMNTIAGVRHVDSIYIRAARSLGASR
LTIFRRVILPAATPYILSGARIGIGTAFIVVIVAEMIAVNNGLGFRILEAREYFWSDKII
AGMLTIGLIGLAIDLAVSRLNNHLLRWHRGLES