Protein Info for GFF2901 in Xanthobacter sp. DMC5

Annotation: C4-dicarboxylate transport transcriptional regulatory protein DctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF00072: Response_reg" amino acids 22 to 131 (110 residues), 96.3 bits, see alignment E=3.2e-31 PF00158: Sigma54_activat" amino acids 161 to 327 (167 residues), 225.8 bits, see alignment E=6.5e-71 PF14532: Sigma54_activ_2" amino acids 162 to 332 (171 residues), 80.4 bits, see alignment E=3.9e-26 PF07728: AAA_5" amino acids 184 to 302 (119 residues), 29 bits, see alignment E=2.5e-10 PF02954: HTH_8" amino acids 411 to 451 (41 residues), 36.8 bits, see alignment 6.6e-13

Best Hits

Swiss-Prot: 54% identical to DCTD_RHILE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium leguminosarum

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 87% identity to xau:Xaut_4048)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>GFF2901 C4-dicarboxylate transport transcriptional regulatory protein DctD (Xanthobacter sp. DMC5)
MFPERAFSAEAEAPRHASRPRVLLVDDEEMIRLSIEQTLDLAGIDVASFASAEAALPAIG
RDYPGIVVTDVRLPARDGLELLADIRRRDPELPVVLITGHGDVAMAVSAMREGAYDFIEK
PFVSDAFVEVVKRALEKRALVLENRRLRTALDRGDAIERHLVGQSAAMRRLRDDVAQLAS
TSADVLVLGETGAGKEQVARALHEGGVRRDKPFVAVNCGAIPESMFESEMFGHEAGAFTG
AGKRRIGKIEHASGGTLFLDEVESMPLAMQVKLLRVLQDRRIERLGSNTPVPVDLRVIAA
TKEDLGALADAGRFRKDLFFRLDVVKLVLPPLRERREDIPLLFELFLVQAAVKYQRPVVE
VPPSLRRALMLADWPGNVRELKNAAERHMLGFLAPDFTGGAAAAPSLNELLDRVERLVIE
DALKASGNRVSAAALALNIPRKTLHDRMKRLGLTTTD