Protein Info for PS417_14840 in Pseudomonas simiae WCS417

Annotation: abortive phage infection protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details PF02517: Rce1-like" amino acids 143 to 234 (92 residues), 44.5 bits, see alignment E=7.8e-16

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfs:PFLU3455)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U482 at UniProt or InterPro

Protein Sequence (245 amino acids)

>PS417_14840 abortive phage infection protein (Pseudomonas simiae WCS417)
MITQGMAVLINYGTYLAPGLLLFGLWFALTPKSLTGMRILILLVAFVLMRDVMTPLGMWS
LGSAVQLAFTANTFVLAALGGLSVLLIALLVRVAPDLSPLILWSKGHRASGLTVGIAVGC
LIGVPLRFYQGIEASAIPGYWVWLPGMVVLAYGANALEEVLFRGYLQGYLEQHVAPLRAA
LVSGVAFAACHAFLALSVTQLGWPVLLFTLIEGLACALVRMRYGVLAATLTHGTAILLVA
VPQMA