Protein Info for GFF2898 in Sphingobium sp. HT1-2

Annotation: Uncharacterized N-acetyltransferase YedL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF00583: Acetyltransf_1" amino acids 27 to 130 (104 residues), 54.4 bits, see alignment E=2.3e-18 PF13508: Acetyltransf_7" amino acids 47 to 130 (84 residues), 45.2 bits, see alignment E=1.6e-15 PF13673: Acetyltransf_10" amino acids 48 to 131 (84 residues), 27.6 bits, see alignment E=3.8e-10

Best Hits

Swiss-Prot: 49% identical to YEDL_ECOLI: Uncharacterized N-acetyltransferase YedL (yedL) from Escherichia coli (strain K12)

KEGG orthology group: K03829, putative acetyltransferase [EC: 2.3.1.-] (inferred from 67% identity to rpe:RPE_1828)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>GFF2898 Uncharacterized N-acetyltransferase YedL (Sphingobium sp. HT1-2)
MFDIREDDLSGAPTRALLAIHLAGMQAESPPESVFALDLSGLRQPGICVWTAWDGDSIAG
VAALRDLGGGQGELKSMRTHPDHLRRGVAAALLRHIIGQARQRGMTRLSLETGSGAAFDP
ALTLYRRHGFGNGEAFGDYRASAFNQFLHLGL