Protein Info for PS417_14815 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 216 to 378 (163 residues), 119.8 bits, see alignment E=5e-39 PF00990: GGDEF" amino acids 219 to 374 (156 residues), 125.6 bits, see alignment E=8.2e-41

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU3448)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UG20 at UniProt or InterPro

Protein Sequence (388 amino acids)

>PS417_14815 diguanylate cyclase (Pseudomonas simiae WCS417)
MTLDPPTILALTVALAAAAALYLAVEWRSVREPSLLCWSTGFATICIGSTLALLRINGYL
MIGIWFANGLLVTAHFLFLLGVARFTQTRLSRLWLLMLVVWLGMLMLPADPLWSKAMLAV
QSLLVALPTLRASFLLRPHGKSLSIGAVQLRYVLLIHGGFYVAKALSVLIPGTLIDLAAF
KGEIIQISLVEGAMAIMLIALSMTGSERYRREQQIARLAARDPLTALYNRRALDLRAPRL
LAQVSPAQPGALLLIDIDNFKSVNDLHGHTAGDRLLIALSEMIRGVVPQGALAARLGGDE
FVILLNPASTEQIVELGSSLRDQFHQLASQTFNTPAPVTLSIGANLFDQPPPSLAALIEQ
GDTALYETKRGGRDNIRLVDRTGASSYG