Protein Info for GFF2881 in Variovorax sp. SCN45

Annotation: Putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details PF04982: TM_HPP" amino acids 19 to 172 (154 residues), 160.3 bits, see alignment E=2.8e-51 PF00571: CBS" amino acids 231 to 284 (54 residues), 47.6 bits, see alignment 1.7e-16 amino acids 314 to 369 (56 residues), 43.6 bits, see alignment 2.9e-15

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 88% identity to vap:Vapar_1760)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF2881 Putative transmembrane protein (Variovorax sp. SCN45)
MRFDALLTHARAWLPARTTVDARERLRAVCGAGLGLLVAALLSHWLATPLHASVWLIAPL
GASAVLVFAVPASPLAQPWSVIGGNTLSAVVGIACANWIPEPTIAAAVAVALAIALMFSA
RCLHPPGGAAALLAVLTHTTHFSSALFPFFTNSLLLVLAGVLYNTLTGRRYPHVQVARPP
AADARFSQADIDAVLARYNQVLDISRDDLESLIQQTELESYKRRLGTLHCADIMSREPIS
VEFGTPLQEAWALMHERRIKALPITDRTRRVVGIVTQADFFRQLDLQHHEGIAGKLRDLI
RATRTVMSNKPEVVGQIMTRQVRVASADRPVVDLVPLFSEGGHHHIPIIDGEKRLAGMIT
QSDFVRALYRAVGPA