Protein Info for PS417_14725 in Pseudomonas simiae WCS417

Updated annotation (from data): Nitrite reductase (NAD(P)H) (EC 1.7.1.4)
Rationale: Specifically important for utilizing Sodium nitrate. Automated validation from mutant phenotype: the predicted function (1.7.1.4) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: nitrite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 TIGR02378: nitrite reductase [NAD(P)H], small subunit" amino acids 12 to 118 (107 residues), 99.4 bits, see alignment E=6e-33 PF13806: Rieske_2" amino acids 12 to 117 (106 residues), 119.6 bits, see alignment E=2.8e-39

Best Hits

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 89% identity to pfs:PFLU3424)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U466 at UniProt or InterPro

Protein Sequence (120 amino acids)

>PS417_14725 Nitrite reductase (NAD(P)H) (EC 1.7.1.4) (Pseudomonas simiae WCS417)
MSQLNTQRNLATWKRVCSESDLVSNSGVVVWLDGAQVALFYLPGAQDQTLYAIDNHDPES
GANVIGRGLIGSIKGDLVVAAPIYKQHYRLEDGQCLEAPDQRLRVWPVRLNGGGVELALD