Protein Info for PS417_01470 in Pseudomonas simiae WCS417

Annotation: cell division protein FtsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR03371: cellulose synthase operon protein YhjQ" amino acids 69 to 309 (241 residues), 174.8 bits, see alignment E=1.1e-55 PF10609: ParA" amino acids 69 to 310 (242 residues), 41.1 bits, see alignment E=4.3e-14 PF13614: AAA_31" amino acids 69 to 109 (41 residues), 34.1 bits, see alignment 7.6e-12 PF06564: CBP_BcsQ" amino acids 70 to 308 (239 residues), 89.1 bits, see alignment E=9.7e-29 PF02374: ArsA_ATPase" amino acids 71 to 112 (42 residues), 25.8 bits, see alignment 1.8e-09 PF01656: CbiA" amino acids 71 to 291 (221 residues), 57.8 bits, see alignment E=3.4e-19

Best Hits

KEGG orthology group: None (inferred from 69% identity to pfs:PFLU0300)

Predicted SEED Role

"Cellulose synthase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYM5 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PS417_01470 cell division protein FtsQ (Pseudomonas simiae WCS417)
MSRADDISKLYDALTGTLRVDQPQVDEPVSPGLQSLLDQLNQGAAPHLYPLELGEGPLCD
VYSEAAAPKVVVVVSAKGGVGRTTLTAALASSLQRQGHPALALDLDPQDGLRHHLAPGVN
MAGVGATSLLNKTWEALPVRGFAGCRVVAFGETDPVQQQSLNRWLGQDLEFLAKRLDGMK
LSGRDTLIIDVPAGNTVYLSQAMSVADVVLVVVQADVASFRSLTQMDRVLAPYLDHAKSP
YRFYVINQVDPAHRFSQDMVDVFKLRLGEAVLGTLQRDPAFIEAQAYGRDPLDPVSNSAA
CRDLSSLCRELLKRIN