Protein Info for GFF2879 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative ECA polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 337 to 361 (25 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details PF06899: WzyE" amino acids 1 to 443 (443 residues), 880.8 bits, see alignment E=1e-269

Best Hits

Swiss-Prot: 100% identical to WZYE_SALTY: Probable ECA polymerase (wzyE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02853, 4-alpha-L-fucosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to sei:SPC_4042)

Predicted SEED Role

"Putative ECA polymerase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>GFF2879 Putative ECA polymerase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSLMQFSGLLVVWLLSTLFIATLTWFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSVLVFR
FDVGVAPPEILLQALLSAACFYGVYYVTYKTRLRKRVVDVPRKPLFTMNRVETHLTWVIL
MGIALVSVAIFFMHNGFLLFRLHSYSQIFSSEVSGVALKRFFYFFIPAMLVVYFLRQDSK
AWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLGIVGM
FWLALKRYGLNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYHNIEFQGLAPIVRDFYVF
IPTWLWPGRPSIVLNSANYFTWEVLNNHSGLAISPTLIGSLVVMGGALFIPLGAIVVGLI
IKWFDWLYELGNREPNRYKAAILHSFCFGAIFNMIVLAREGLDSFVSRVVFFLVVFGASL
LVAKLLFWLFDSAGLIHKRTTSLPQAQVEGKL