Protein Info for GFF2873 in Sphingobium sp. HT1-2

Annotation: 2-pyrone-4,6-dicarboxylic acid hydrolase (EC 3.1.1.57)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF04909: Amidohydro_2" amino acids 28 to 290 (263 residues), 177.6 bits, see alignment E=2.5e-56

Best Hits

Swiss-Prot: 86% identical to LIGI_SPHSK: 2-pyrone-4,6-dicarboxylate hydrolase (ligI) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K10221, 2-pyrone-4,6-dicarboxylate lactonase [EC: 3.1.1.57] (inferred from 90% identity to nar:Saro_2819)

MetaCyc: 86% identical to 2-pyrone-4,6-dicarboxylate hydrolase (Sphingomonas sp. SYK6)
2-pyrone-4,6-dicarboxylate lactonase. [EC: 3.1.1.57]

Predicted SEED Role

"2-pyrone-4,6-dicarboxylic acid hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF2873 2-pyrone-4,6-dicarboxylic acid hydrolase (EC 3.1.1.57) (Sphingobium sp. HT1-2)
MTAPELGRIISWHGNPSKPRYTPPAGAIDAHCHVFGPMAQFPFSAKAKYLPEDAGPDMLF
ALRDHLGFARNVIVQASCHGTDNAATLDAIAKSNGKARGVAVVDPAISEADLAALHEGGM
RGIRFNFLKRLVDDAPKDKFLEVAKRLPKGWHVVIYFEADILEELRPFMDAIPVPLVIDH
MGRPDVTQGPGGADMKAFHAFLDSRDDIWFKATCPDRLDPTGDPWNAFADAVAPLVADYQ
DRVLWGTDWPHPNMQDAIPDDGHLVDMIPRIAPTVELQRKLLIDNPMRLYWPEEL