Protein Info for PS417_14655 in Pseudomonas simiae WCS417

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 68 (27 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details PF01810: LysE" amino acids 17 to 203 (187 residues), 103.3 bits, see alignment E=5.9e-34

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_2401)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TZR7 at UniProt or InterPro

Protein Sequence (206 amino acids)

>PS417_14655 lysine transporter LysE (Pseudomonas simiae WCS417)
MSITDNLLAFTFAATLLTLTPGLDTALVLRTATVEGKRQALQAMLGINAGCLLWGAAVAF
GLGALVAVSEVAFNLLKYCGAAYLAWLGLNMLLRPRRSLTNAGADAKPAGNWLVKGMLGN
VLNPKVGIFYVSFLPQFIPQGQPLILWTFGLVSIHVLLGLAWSLVLIGATQPLSGFLRRE
KVIQWMDRTTGMIFVLFAARLAFSKR