Protein Info for GFF2867 in Sphingobium sp. HT1-2

Annotation: Protocatechuate 4,5-dioxygenase alpha chain (EC 1.13.11.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR02792: protocatechuate 4,5-dioxygenase, alpha subunit" amino acids 12 to 128 (117 residues), 196.2 bits, see alignment E=8.2e-63 PF07746: LigA" amino acids 32 to 117 (86 residues), 117.2 bits, see alignment E=1.4e-38

Best Hits

Swiss-Prot: 70% identical to PCYA_SPHSK: Protocatechuate 4,5-dioxygenase alpha chain (ligA) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K04100, protocatechuate 4,5-dioxygenase, alpha chain [EC: 1.13.11.8] (inferred from 83% identity to npp:PP1Y_Mpl10445)

MetaCyc: 70% identical to protocatechuate 4,5-dioxygenase alpha chain (Sphingomonas sp. SYK6)
Protocatechuate 4,5-dioxygenase. [EC: 1.13.11.8]; 1.13.11.- [EC: 1.13.11.8]; RXN-10889 [EC: 1.13.11.8]

Predicted SEED Role

"Protocatechuate 4,5-dioxygenase alpha chain (EC 1.13.11.8)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 1.13.11.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.8

Use Curated BLAST to search for 1.13.11.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>GFF2867 Protocatechuate 4,5-dioxygenase alpha chain (EC 1.13.11.8) (Sphingobium sp. HT1-2)
MSIDIHEYLAEFDDIPGTRVYTAARARQGYWMNQFAMSLMKAENRVRWLAGERAYIDEWP
MTEAQKQAILDRDYNRCLDLGGNIYFLAKVFSTDGLSFLQAVGTMTGMSPEDYQAMMIAG
GRSPQGVRSIKEKR