Protein Info for PS417_14640 in Pseudomonas simiae WCS417

Annotation: dihydrodipicolinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00701: DHDPS
  • amino acids 4 to 283 (280 residues), 182.6 bits, E=3.6e-58
• TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase
  • amino acids 9 to 284 (276 residues), 224 bits, E=9e-71

Best Hits

Swiss-Prot: 37% identical to DAPA_PELPD: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 91% identity to pfs:PFLU3405)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.52, 4.3.3.7

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Sequence Analysis Tools

See A0A1N7U253 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PS417_14640 dihydrodipicolinate synthase (Pseudomonas simiae WCS417)
MSSFQGIWVPVVTPFHDGAIDFTGLHRLVSHLLEKHVAGIMVCTTTGEAAALSRQEQLAV
LDAVLQWVPAHRVVMGLAGYNQIELLQFQREILQRPVAGLLVPAPSYIRPSQAGLEAFFR
TVADASSVPIILYDIPYRTGATFEQATLLNIVAHERIVAIKDCGGNLGNTLALLASGDVE
VLCGEDVQIFNALCLGATGAIAASAHLQTEQFVALCQLVRDNQLAEARATFFELLPLINA
MFMEPNPAPVKAALALQGLIGSELRAPMQAASTAVVARLQQVLNPTR