Protein Info for GFF2862 in Xanthobacter sp. DMC5

Annotation: Muconate cycloisomerase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR02534: muconate and chloromuconate cycloisomerases" amino acids 19 to 383 (365 residues), 568.1 bits, see alignment E=4.2e-175 PF02746: MR_MLE_N" amino acids 28 to 142 (115 residues), 107.1 bits, see alignment E=6.4e-35 PF13378: MR_MLE_C" amino acids 165 to 376 (212 residues), 166.3 bits, see alignment E=8.9e-53

Best Hits

Swiss-Prot: 76% identical to CATB1_ACILW: Muconate cycloisomerase 1-1 (catB1) from Acinetobacter lwoffii

KEGG orthology group: K01856, muconate cycloisomerase [EC: 5.5.1.1] (inferred from 80% identity to pde:Pden_1174)

MetaCyc: 62% identical to muconate cycloisomerase (Pseudomonas reinekei)
Muconate cycloisomerase. [EC: 5.5.1.1]

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.5.1.1

Use Curated BLAST to search for 5.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>GFF2862 Muconate cycloisomerase 1 (Xanthobacter sp. DMC5)
MNATFAHPVPTSAPARAVIERVETALIDLPTIRPHKLSVATMNGQTLMLVRVLCSDGVVG
IGEGTTIGGLAYGGESPESMKLAVDTYFAPLMVGQDATAVRALMLRIGKMVKDNRFAKSA
VETALLDAQGKRLGQPVSELLGGRLRSRLPVAWTLASGDTAKDIAEAEKMLELRRHRIFK
LKIGARTPAADVAHVATIKRALGDRGAVRVDVNMAWSETEAAYGMAALADAGCELVEQPV
ATAAGLARLVRRFPVALMADESLQGPESAFEIARHAGADVFAIKIEQSGGLFQAQRVAAI
ADAAGIGLYGGTMLEGAVGTIASAQLFSTFVNLQWGTELFGPLLLTEEILATPLTYADFE
LTVPAGPGLGIALDEDRVDFFTRGRPRKTASVAV