Protein Info for GFF2858 in Xanthobacter sp. DMC5

Annotation: 4-hydroxybenzoate transporter PcaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 22 to 435 (414 residues), 130 bits, see alignment E=1.9e-41 PF07690: MFS_1" amino acids 28 to 303 (276 residues), 132.3 bits, see alignment E=3e-42 amino acids 257 to 430 (174 residues), 56.3 bits, see alignment E=4.1e-19 PF06779: MFS_4" amino acids 38 to 196 (159 residues), 41 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 45% identical to BENK_ACIAD: Benzoate transport protein (benK) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05548, MFS transporter, AAHS family, benzoate transport protein (inferred from 79% identity to pde:Pden_1181)

Predicted SEED Role

"benzoate MFS transporter BenK" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF2858 4-hydroxybenzoate transporter PcaK (Xanthobacter sp. DMC5)
MRNIDITDAIDKAPFGRFQWMVAALCGLLLVVDGYDVFVAGTVLPALMKEWGLSKPQAGT
LQAWALFGMMFGALVFGPLADRIGRKKGIAICFLLFTTSTLLAGFANSPTQFGIFRFIAG
LGCGGLMPNTVALMNEYAPKRLRSTMVAVMFSGYSVGGMVAAGFGIGLIPQFGWKPMFFI
AAVPLLLLPLVLWKLPESLGFLLRQGKEAEARAIWAKVAPSARLEASDRLVFTESKSTSA
SVIELFRDQRAVSTVMLWAAFFCCLLLVYLLSSWLPKVLQEVGYAETASLLSLFSLNFGG
MLGAILGGRLGDRFGLPRVVVGFFTAAAVSIALIGFGLPAPLLFVMVFIAGATTIGTQIL
LYASVAQLYNLSIRSTGLGWASGVGRIGAIVGPTLGGVLLAQELPLQQNFLIFAVPAALS
ALAMLVFAVNAARRTATVTAVATA