Protein Info for GFF2856 in Sphingobium sp. HT1-2

Annotation: 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF10370: Rv2993c-like_N" amino acids 1 to 39 (39 residues), 24.7 bits, see alignment 3.5e-09 PF01557: FAA_hydrolase" amino acids 68 to 272 (205 residues), 230.4 bits, see alignment E=1.9e-72

Best Hits

KEGG orthology group: None (inferred from 69% identity to nar:Saro_3416)

Predicted SEED Role

"Putative fumarylacetoacetate (FAA) hydrolase" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF2856 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) (Sphingobium sp. HT1-2)
MRYVSFRRPDGTPSFGRIEGETIVELATDAAPSLKAALTDGSLSGLADGASYAAADVVLL
PVIPDPAKILCVGLNYAEHVKETGREQKAHPAIFVRYADSLIADGQPMVKPAVTERFDYE
GELALVIGKPAHKVAAADAWDYVAGYAAFNDGSARDWQRHNIQFTPGKTFPGTGGFGPAL
VTPDEIEDLQALRVQTRLNGELVQDQPVSDMIWDIPTVIEYVTAFTPLSPGDVIATGTPG
GVGDKRTPPLYMKAGDKVEVTIGTIGTLSNRIIDEQ